PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C022318P2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family SBP
Protein Properties Length: 329aa    MW: 35993.5 Da    PI: 8.5527
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C022318P2genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP127.36.1e-4050126278
                     -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
             SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                     C v+gC++dls++++yhrrhkvCe hsk+p+v++ g+eqrfCqqCsrfh+l efD++krsCr+rL++hn+rrrk+q+
  MELO3C022318P2  50 CMVDGCSSDLSKCRDYHRRHKVCELHSKTPKVTICGQEQRFCQQCSRFHSLAEFDDRKRSCRKRLDGHNRRRRKPQP 126
                     **************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.104.5E-3343111IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.86447124IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.83E-3748129IPR004333Transcription factor, SBP-box
PfamPF031102.4E-2950123IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 329 aa     Download sequence    Send to blast
MYWELRGIGN MDERSMDDMK GTRVALIESS SSRLMKRSRA PGSGAQVPSC MVDGCSSDLS  60
KCRDYHRRHK VCELHSKTPK VTICGQEQRF CQQCSRFHSL AEFDDRKRSC RKRLDGHNRR  120
RRKPQPATMT LNAGRFLYGN QGPRFLPFGN QLLSASSDVS SSWIGMIKPE NNAPLCGGNS  180
QFDFTDRRKS MLPGSLSSDY KEKQLAISCI PIGLLPKSSD TQPFLNVGSS NGGNVQKVLG  240
NGSNRFFDSD CALSLLSTPV EPGEINLSSM SQSNLIPPAH FIHSDGLGLE GDPISSGLVS  300
DGSSDANIRC YSTFQDGPDG SSGDLFRF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A3e-27501231184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1105122RKRSCRKRLDGHNRRRRK
2105123RKRSCRKRLDGHNRRRRKP
3106123KRSCRKRLDGHNRRRRKP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6819250.0LN681925.1 Cucumis melo genomic scaffold, anchoredscaffold00052.
GenBankLN7132650.0LN713265.1 Cucumis melo genomic chromosome, chr_11.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008459851.10.0PREDICTED: squamosa promoter-binding-like protein 16
TrEMBLA0A0A0KAG40.0A0A0A0KAG4_CUCSA; Uncharacterized protein
STRINGVIT_01s0010g03910.t012e-96(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF25913378
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G50670.13e-45SBP family protein